Beinaglutide,123475-27-4,china peptide

मूल जानकारी:

Key words: Beinaglutide,123475-27-4,china peptide

बुनियादी पैरामीटर:

chinese name: Benaglutide

अंग्रेजी नाम:बोन गैप

product number:

CAS No. 123475-27-4

sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

आणविक सूत्र: C149H225N39O46

molecular weight: 3298.61


उत्पाद विवरण

Dirction:Beinaglutide (CAS 123475‑27‑4) is recombinant human GLP‑1 peptide with molecular weight 3298.67. It is produced by solid‑phase peptide synthesis, supplied as lyophilized white powder. Suitable for GLP‑1 receptor‑related in‑vitro and pre‑clinical research. HPLC purity ≥98%, store at ‑20℃ for stable long‑term preservation.

Beinaglutide,123475-27-4,china peptide

 मूल जानकारी:

ब्रांड: ठोस विस्तार

उपस्थिति लक्षण:सफ़ेदपाउडर

भंडारण: छायांकन, ठंडासुखाने,सीलबंद संरक्षण शुद्धता: ≥ 99% मुख्य उपयोग: पॉलीपेप्टाइड अनुसंधान उपयोग

कार्यान्वयनमानक: उद्यम मानक

विशेष विवरण:मिलीग्राम/ग्राम/किग्रा, आदि (ग्राहक की आवश्यकताओं के अधीन)

बिक्री का दायरा: वैश्विक

पेप्टाइड अक्सर पूछे जाने वाले प्रश्न:

q: What situations should be considered using designer peptides as antigens?

Answer: If the amino acid sequence is known, but the antigen protein cannot be obtained due to gene cloning or expression, or only antibodies to certain specific epitopes of the antigen protein need to be obtained, the antigen can be obtained by polypeptide synthesis. For example, it is only necessary to produce specific antibodies to a certain region of the protein, such as the N-terminal precursor of the protein, and the N-terminal polypeptide antigen can be designed. If the antibody is used to recognize modified amino acids, such as phosphorylated serine, threonine or tyrosine, acetylated lysine, etc., the polypeptide must be modified accordingly. Antisera generally recognize the polypeptide sequence used for immunization, but not necessarily the folded structure of the native protein. Whether an antibody to a non-continuous antigen can recognize an antigenic determinant depends on whether the polypeptide used for antibody production has a secondary structure.


  • पहले का:
  • अगला: